OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RANBP10 (NM_020850) Human Mass Spec Standard

Be the first to review this product
SKU
PH310540
RANBP10 MS Standard C13 and N15-labeled recombinant protein (NP_065901)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306949 Rabbit Polyclonal RANBP10 Antibody
100 ug
$640.00
LY412269 Transient overexpression lysate of RAN binding protein 10 (RANBP10) (as WB positive control) 100 ug
$436.00

Other products for "RANBP10 or NM_020850"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210540
Predicted MW 67.2 kDa
Protein Sequence
Protein Sequence
>RC210540 protein sequence
Red=Cloning site Green=Tags(s)

MAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPKDKYNYIGLSQ
GNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSY
GYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTCFYTKNGHSLGIAFTDLPANLYPTVGLQTPG
EIVDANFGQQPFPFDIEDYMREWRAKVQGTVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARM
TETPIQEEQASIKNRQKIQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRS
LSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSS
SSPSSVNYSESNSTDSTKSQHHSSTSNQETSDSEVEMEAEHYPNGVLGSMSTRIVNGAYKHEDLQTDESS
MDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQDAFSLLAYSDPWSCPVGQQL
DPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLRLMARAGLGSCSFARVDDYLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065901
RefSeq Size 5305
RefSeq ORF 1860
Locus ID 57610
UniProt ID Q6VN20
Cytogenetics 16q22.1
Summary RAN is a small GTPase involved in the assembly of microtubules to form mitotic spindles. The protein encoded by this gene is a cytoplasmic guanine nucleotide exchange factor (GEF) that binds beta-tubulin and has GEF activity toward RAN. The encoded protein plays a role in the formation of noncentrosomal microtubules. In addition, this protein may be involved in the regulation of D(1) receptor signaling by protein kinase C delta and protein kinase C gamma. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RANBP10" proteins (3)
SKU Description Size Price
LC412269 Lyophilized RANBP10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412269 Transient overexpression lysate of RAN binding protein 10 (RANBP10) (as WB positive control) 100 ug
$436.00
TP310540 Recombinant protein of human RAN binding protein 10 (RANBP10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products