OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OXLD1 (NM_001039842) Human Mass Spec Standard

Be the first to review this product
SKU
PH310536
C17orf90 MS Standard C13 and N15-labeled recombinant protein (NP_001034931)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY421836 Transient overexpression lysate of chromosome 17 open reading frame 90 (C17orf90) (as WB positive control) 100 ug
$436.00

Other products for "OXLD1 or NM_001039842"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210536
Predicted MW 15.9 kDa
Protein Sequence
Protein Sequence
>RC210536 protein sequence
Red=Cloning site Green=Tags(s)

MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGA
DGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIR
LHTRCGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034931
RefSeq Size 635
RefSeq ORF 441
Synonyms C17orf90
Locus ID 339229
UniProt ID Q5BKU9
Cytogenetics 17q25.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OXLD1" proteins (3)
SKU Description Size Price
LC421836 Lyophilized OXLD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421836 Transient overexpression lysate of chromosome 17 open reading frame 90 (C17orf90) (as WB positive control) 100 ug
$436.00
TP310536 Recombinant protein of human chromosome 17 open reading frame 90 (C17orf90), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products