OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRRX1 (NM_022716) Human Mass Spec Standard

Be the first to review this product
SKU
PH310393
PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_073207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803116 PRRX1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10) 100 ul
$447.00
LY411607 Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1b (as WB positive control) 100 ug
$436.00

Other products for "PRRX1 or NM_022716"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210393
Predicted MW 27.3 kDa
Protein Sequence
Protein Sequence
>RC210393 protein sequence
Red=Cloning site Green=Tags(s)

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL
TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV
WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA
NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073207
RefSeq Size 3999
RefSeq ORF 735
Synonyms AGOTC; PHOX1; PMX1; PRX-1; PRX1
Locus ID 5396
UniProt ID P54821
Cytogenetics 1q24.2
Summary The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRRX1" proteins (7)
SKU Description Size Price
PH313276 PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_008833) 10 ug
$3,360.00
LC411607 Lyophilized PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416343 Lyophilized PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411607 Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1b (as WB positive control) 100 ug
$436.00
LY416343 Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1a (as WB positive control) 100 ug
$436.00
TP310393 Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1b, 20 µg 20 ug
$867.00
TP313276 Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products