OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLAMF9 (NM_033438) Human Mass Spec Standard

Be the first to review this product
SKU
PH310366
SLAMF9 MS Standard C13 and N15-labeled recombinant protein (NP_254273)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320066 Rabbit Polyclonal SLAMF9 Antibody
100 ug
$640.00
LY409497 Transient overexpression lysate of SLAM family member 9 (SLAMF9), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SLAMF9 or NM_033438"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210366
Predicted MW 32.4 kDa
Protein Sequence
Protein Sequence
>RC210366 protein sequence
Red=Cloning site Green=Tags(s)

MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEG
HPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITV
NFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVS
SCPIPDGPFYADPNYASEKPSTAFCLLAKGLLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRK
EAKPGSSPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_254273
RefSeq Size 1170
RefSeq ORF 867
Synonyms CD2F-10; CD2F10; CD84-H1; CD84H1; SF2001
Locus ID 89886
UniProt ID Q96A28
Cytogenetics 1q23.2
Summary This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variants.provided by RefSeq, Apr 2009
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLAMF9" proteins (3)
SKU Description Size Price
LC409497 Lyophilized SLAMF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409497 Transient overexpression lysate of SLAM family member 9 (SLAMF9), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310366 Recombinant protein of human SLAM family member 9 (SLAMF9), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products