OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p53R2 (RRM2B) (NM_015713) Human Mass Spec Standard

Be the first to review this product
SKU
PH310340
RRM2B MS Standard C13 and N15-labeled recombinant protein (NP_056528)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306062 Rabbit Polyclonal p53R2 Antibody
100 ug
$640.00
LY414401 Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B) (as WB positive control) 100 ug
$436.00

Other products for "p53R2 or NM_015713"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210340
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC210340 protein sequence
Red=Cloning site Green=Tags(s)

MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD
LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL
LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK
RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI
LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD
F

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056528
RefSeq Size 4932
RefSeq ORF 1053
Synonyms MTDPS8A; MTDPS8B; P53R2
Locus ID 50484
UniProt ID Q7LG56
Cytogenetics 8q22.3
Summary This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described.provided by RefSeq, Feb 2010
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "p53R2" proteins (5)
SKU Description Size Price
LC414401 Lyophilized RRM2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433055 Lyophilized RRM2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414401 Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B) (as WB positive control) 100 ug
$436.00
LY433055 Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310340 Recombinant protein of human ribonucleotide reductase M2 B (TP53 inducible) (RRM2B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products