OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

H2AC6 (NM_003512) Human Mass Spec Standard

Be the first to review this product
SKU
PH310259
HIST1H2AC MS Standard C13 and N15-labeled recombinant protein (NP_003503)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418636 Transient overexpression lysate of histone cluster 1, H2ac (HIST1H2AC) (as WB positive control) 100 ug
$436.00

Other products for "H2AC6 or NM_003512"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210259
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC210259 representing NM_003512
Red=Cloning site Green=Tags(s)

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003503
RefSeq Size 546
RefSeq ORF 390
Synonyms dJ221C16.4; H2A/l; H2AFL; HIST1H2AC
Locus ID 8334
UniProt ID Q93077
Cytogenetics 6p22.2
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. provided by RefSeq, Aug 2015
Protein Pathways Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "H2AC6" proteins (3)
SKU Description Size Price
LC418636 Lyophilized HIST1H2AC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418636 Transient overexpression lysate of histone cluster 1, H2ac (HIST1H2AC) (as WB positive control) 100 ug
$436.00
TP310259 Recombinant protein of human histone cluster 1, H2ac (HIST1H2AC), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products