OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPA33 (NM_005814) Human Mass Spec Standard

Be the first to review this product
SKU
PH310225
GPA33 MS Standard C13 and N15-labeled recombinant protein (NP_005805)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417048 Transient overexpression lysate of glycoprotein A33 (transmembrane) (GPA33) (as WB positive control) 100 ug
$436.00

Other products for "GPA33 or NM_005814"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210225
Predicted MW 35.6 kDa
Protein Sequence
Protein Sequence
>RC210225 protein sequence
Red=Cloning site Green=Tags(s)

MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV
IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP
PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI
CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA
YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005805
RefSeq Size 2793
RefSeq ORF 957
Synonyms A33
Locus ID 10223
UniProt ID Q99795
Cytogenetics 1q24.1
Summary The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPA33" proteins (5)
SKU Description Size Price
LC417048 Lyophilized GPA33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417048 Transient overexpression lysate of glycoprotein A33 (transmembrane) (GPA33) (as WB positive control) 100 ug
$436.00
TP310225 Recombinant protein of human glycoprotein A33 (transmembrane) (GPA33), 20 µg 20 ug
$867.00
TP720397 Purified recombinant protein of Homo sapiens glycoprotein A33 (transmembrane) (GPA33) 10 ug
$275.00
TP762369 Purified recombinant protein of Human glycoprotein A33 (transmembrane) (GPA33), Ile22-Val235-GGGGS-Tyr257-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products