OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RELM beta (RETNLB) (NM_032579) Human Mass Spec Standard

Be the first to review this product
SKU
PH310104
RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322138 Anti-RETNLB Rabbit Polyclonal Antibody
100 ul
$305.00
LY410034 Transient overexpression lysate of resistin like beta (RETNLB) (as WB positive control) 100 ug
$436.00

Other products for "RELM beta or NM_032579"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210104
Predicted MW 11.7 kDa
Protein Sequence
Protein Sequence
>RC210104 protein sequence
Red=Cloning site Green=Tags(s)

MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG
MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115968
RefSeq Size 594
RefSeq ORF 333
Synonyms FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2
Locus ID 84666
UniProt ID Q9BQ08
Cytogenetics 3q13.13
Summary Probable hormone.UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RELM beta" proteins (3)
SKU Description Size Price
LC410034 Lyophilized RETNLB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410034 Transient overexpression lysate of resistin like beta (RETNLB) (as WB positive control) 100 ug
$436.00
TP310104 Recombinant protein of human resistin like beta (RETNLB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products