OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFCAB4A (CRACR2B) (NM_173584) Human Mass Spec Standard

Be the first to review this product
SKU
PH310060
EFCAB4A MS Standard C13 and N15-labeled recombinant protein (NP_775855)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320157 Rabbit Polyclonal EFCAB4A Antibody
100 ug
$640.00
LY406490 Transient overexpression lysate of EF-hand calcium binding domain 4A (EFCAB4A) (as WB positive control) 100 ug
$436.00

Other products for "EFCAB4A or NM_173584"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210060
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC210060 protein sequence
Red=Cloning site Green=Tags(s)

MASPGKPGADEAQEEEGELEGGSAGPRAAILEQAEELFLLCDKEAKGFITKHDLQGLQSDLPLTPEQLEA
VFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEEEEEEERFHT
VLEQLGVAPVLGEQRAVRTLWARLQRERPELLGSFEDVLIRASACLEEAARERDGLEQALRRRESEHERE
VRALYEETEQLREQSRRPPSQNFARGERRSRLELELQIREQDLERAGLRQRERRGRRLQEHAERESQPAT
ATGAAQGAEYTAAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775855
RefSeq Size 1681
RefSeq ORF 882
Synonyms EFCAB4A
Locus ID 283229
UniProt ID Q8N4Y2
Cytogenetics 11p15.5
Summary Plays a role in store-operated Ca(2+) entry (SOCE).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFCAB4A" proteins (3)
SKU Description Size Price
LC406490 Lyophilized CRACR2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406490 Transient overexpression lysate of EF-hand calcium binding domain 4A (EFCAB4A) (as WB positive control) 100 ug
$436.00
TP310060 Recombinant protein of human EF-hand calcium binding domain 4A (EFCAB4A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products