OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCL3 (NM_002983) Human Mass Spec Standard

Be the first to review this product
SKU
PH310026
CCL3 MS Standard C13 and N15-labeled recombinant protein (NP_002974)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374358 CCL3 Rabbit polyclonal Antibody
100 ul
$410.00
LY418970 Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) (as WB positive control) 100 ug
$436.00

Other products for "CCL3 or NM_002983"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210026
Predicted MW 10.1 kDa
Protein Sequence
Protein Sequence
>RC210026 protein sequence
Red=Cloning site Green=Tags(s)

MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR
QVCADPSEEWVQKYVSDLELSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002974
RefSeq Size 813
RefSeq ORF 276
Synonyms G0S19-1; LD78ALPHA; MIP-1-alpha; MIP1A; SCYA3
Locus ID 6348
UniProt ID P10147
Cytogenetics 17q12
Summary This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.provided by RefSeq, Sep 2010
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCL3" proteins (5)
SKU Description Size Price
LC418970 Lyophilized CCL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418970 Transient overexpression lysate of chemokine (C-C motif) ligand 3 (CCL3) (as WB positive control) 100 ug
$436.00
TP310026 Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3), 20 µg 20 ug
$867.00
TP720049 Recombinant protein of human chemokine (C-C motif) ligand 3 (CCL3) 10 ug
$290.00
TP790113 Purified recombinant protein of Human chemokine (C-C motif) ligand 3 (CCL3), esidues 24-92aa, with N-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products