OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLAC9 (NM_001012973) Human Mass Spec Standard

Be the first to review this product
SKU
PH309859
PLAC9 MS Standard C13 and N15-labeled recombinant protein (NP_001012991)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342546 Rabbit Polyclonal Anti-PLAC9 Antibody
100 ul
$585.00
LY422936 Transient overexpression lysate of placenta-specific 9 (PLAC9) (as WB positive control) 100 ug
$436.00

Other products for "PLAC9 or NM_001012973"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209859
Predicted MW 10.3 kDa
Protein Sequence
Protein Sequence
>RC209859 protein sequence
Red=Cloning site Green=Tags(s)

MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGL
LGLLEELAWNLPPGPFSPAPDLLGDGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012991
RefSeq Size 691
RefSeq ORF 291
Locus ID 219348
UniProt ID Q5JTB6
Cytogenetics 10q22.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLAC9" proteins (3)
SKU Description Size Price
LC422936 Lyophilized PLAC9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422936 Transient overexpression lysate of placenta-specific 9 (PLAC9) (as WB positive control) 100 ug
$436.00
TP309859 Recombinant protein of human placenta-specific 9 (PLAC9), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products