PSMD14 (NM_005805) Human Mass Spec Standard
CAT#: PH309829
PSMD14 MS Standard C13 and N15-labeled recombinant protein (NP_005796)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209829 |
Predicted MW | 34.6 kDa |
Protein Sequence |
>RC209829 protein sequence
Red=Cloning site Green=Tags(s) MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005796 |
RefSeq Size | 1734 |
RefSeq ORF | 930 |
Synonyms | PAD1; POH1; RPN11 |
Locus ID | 10213 |
UniProt ID | O00487, A0A140VKF2 |
Cytogenetics | 2q24.2 |
Summary | This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401764 | PSMD14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401764 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14) |
USD 436.00 |
|
TP309829 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review