OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C8ORF41 (TTI2) (NM_025115) Human Mass Spec Standard

Be the first to review this product
SKU
PH309782
C8orf41 MS Standard C13 and N15-labeled recombinant protein (NP_079391)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331723 Rabbit Polyclonal Anti-TTI2 Antibody
100 ul
$585.00
LY410894 Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "C8ORF41 or NM_025115"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209782
Predicted MW 56.9 kDa
Protein Sequence
Protein Sequence
>RC209782 protein sequence
Red=Cloning site Green=Tags(s)

MELDSALEAPSQEDSNLSEELSHSAFGQAFSKILHCLARPEARRGNVKDAVLKDLGDLIEATEFDRLFEG
TGARLRGMPETLGQVAKALEKYAAPSKEEEGGGDGHSEAAEKAAQVGLLFLKLLGKVETAKNSLVGPAWQ
TGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSVILGLL
KPDLYKESWKNNPAIKHVFSWTLQQVTRPWLSQHLERVLPASLVISDDYQTENKILGVHCLHHIVLNVPA
ADLLQYNRAQVLYHAISNHLYTPEHHLIQAVLLCLLDLFPILEKTLHWKGDGARPTTHCDEVLRLILTHM
EPEHRLLLRRTYARNLPAFVNRLGILTVRHLKRLERVIIGYLEVYDGPEEEARLKILETLKLLMQHTWPR
VSCRLVVLLKALLKLICDVARDPNLTPESVKSALLQEATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVV
NYIRKVQQVSEGAPYNGT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079391
RefSeq Size 2763
RefSeq ORF 1524
Synonyms C8orf41; MRT39
Locus ID 80185
UniProt ID Q6NXR4
Cytogenetics 8p12
Summary This gene encodes a regulator of the DNA damage response. The protein is a component of the Triple T complex (TTT) which also includes telomere length regulation protein and TELO2 interacting protein 1. The TTT complex is involved in cellular resistance to DNA damage stresses and may act as a regulator of phosphoinositide-3-kinase-related protein kinase (PIKK) abundance. provided by RefSeq, May 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C8ORF41" proteins (5)
SKU Description Size Price
LC410894 Lyophilized TTI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420143 Lyophilized TTI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410894 Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420143 Transient overexpression lysate of chromosome 8 open reading frame 41 (C8orf41), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP309782 Recombinant protein of human chromosome 8 open reading frame 41 (C8orf41), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products