OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRP15 (LRRC3B) (NM_052953) Human Mass Spec Standard

Be the first to review this product
SKU
PH309766
LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409370 Transient overexpression lysate of leucine rich repeat containing 3B (LRRC3B) (as WB positive control) 100 ug
$436.00

Other products for "LRP15 or NM_052953"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209766
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC209766 protein sequence
Red=Cloning site Green=Tags(s)

MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLY
LDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARA
RIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTM
FGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443185
RefSeq Size 1718
RefSeq ORF 777
Synonyms LRP15
Locus ID 116135
UniProt ID Q96PB8
Cytogenetics 3p24.1
Summary The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Dec 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRP15" proteins (3)
SKU Description Size Price
LC409370 Lyophilized LRRC3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409370 Transient overexpression lysate of leucine rich repeat containing 3B (LRRC3B) (as WB positive control) 100 ug
$436.00
TP309766 Recombinant protein of human leucine rich repeat containing 3B (LRRC3B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products