OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC26 (NM_139286) Human Mass Spec Standard

Be the first to review this product
SKU
PH309719
CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308099 Rabbit polyclonal antibody to CDC26 (cell division cycle 26 homolog (S. cerevisiae))
100 ul
$665.00
LY408342 Transient overexpression lysate of cell division cycle 26 homolog (S. cerevisiae) (CDC26) (as WB positive control) 100 ug
$436.00

Other products for "CDC26 or NM_139286"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209719
Predicted MW 9.8 kDa
Protein Sequence
Protein Sequence
>RC209719 protein sequence
Red=Cloning site Green=Tags(s)

MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ
PKPNNRSSQFGSLEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_644815
RefSeq Size 885
RefSeq ORF 255
Synonyms ANAPC12; APC12; C9orf17
Locus ID 246184
UniProt ID Q8NHZ8
Cytogenetics 9q32
Summary The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. provided by RefSeq, Jul 2008
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC26" proteins (3)
SKU Description Size Price
LC408342 Lyophilized CDC26 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408342 Transient overexpression lysate of cell division cycle 26 homolog (S. cerevisiae) (CDC26) (as WB positive control) 100 ug
$436.00
TP309719 Recombinant protein of human cell division cycle 26 homolog (S. cerevisiae) (CDC26), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products