OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CENPL (NM_033319) Human Mass Spec Standard

Be the first to review this product
SKU
PH309587
CENPL MS Standard C13 and N15-labeled recombinant protein (NP_201576)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335421 Rabbit Polyclonal Anti-CENPL Antibody
100 ul
$585.00
LY409603 Transient overexpression lysate of centromere protein L (CENPL), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CENPL or NM_033319"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209587
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC209587 protein sequence
Red=Cloning site Green=Tags(s)

MDSYSAPESTPSASSRPEDYFIGATPLQKRLESVRKQSSFILTPPRRKIPQCSQLQEDVDPQKVAFLLHK
QWTLYSLTPLYKFSYSNLKEYSRLLNAFIVAEKQKGLAVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQ
IVSKSQLPSENREGKVLWTGWFCCVFGDSLLETVSEDFTCLPLFLANGAESNTAIIGTWFQKTFDCYFSP
LAINAFNLSWMAAMWTACKMDHYVATTEFLWSVPCSPQSLDISFAIHPEDAKALWDSVHKTPGEVTQEEV
DLFMDCLYSHFHRHFKIHLSATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYLTELAIFQIE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_201576
RefSeq Size 2555
RefSeq ORF 1032
Synonyms C1orf155; CENP-L; dJ383J4.3
Locus ID 91687
UniProt ID Q8N0S6
Cytogenetics 1q25.1
Summary CENPL is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006) PubMed 16622420.supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CENPL" proteins (5)
SKU Description Size Price
LC409603 Lyophilized CENPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432913 Lyophilized CENPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409603 Transient overexpression lysate of centromere protein L (CENPL), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432913 Transient overexpression lysate of centromere protein L (CENPL), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP309587 Recombinant protein of human centromere protein L (CENPL), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products