OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM81 (NM_203376) Human Mass Spec Standard

Be the first to review this product
SKU
PH309585
TMEM81 MS Standard C13 and N15-labeled recombinant protein (NP_976310)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404318 Transient overexpression lysate of transmembrane protein 81 (TMEM81) (as WB positive control) 100 ug
$436.00

Other products for "TMEM81 or NM_203376"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209585
Predicted MW 28.5 kDa
Protein Sequence
Protein Sequence
>RC209585 protein sequence
Red=Cloning site Green=Tags(s)

MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEETVCEVGPDGV
RRKCQTRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQA
NSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLD
SYSKPHHPKWKKKVASALGIGIAIGVVGGVLVRIVLCALRGGLQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976310
RefSeq Size 1350
RefSeq ORF 765
Synonyms HC3107; KVLA2788; UNQ2788
Locus ID 388730
UniProt ID Q6P7N7
Cytogenetics 1q32.1
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM81" proteins (3)
SKU Description Size Price
LC404318 Lyophilized TMEM81 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404318 Transient overexpression lysate of transmembrane protein 81 (TMEM81) (as WB positive control) 100 ug
$436.00
TP309585 Recombinant protein of human transmembrane protein 81 (TMEM81), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products