OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B7 (NM_016371) Human Mass Spec Standard

Be the first to review this product
SKU
PH309534
HSD17B7 MS Standard C13 and N15-labeled recombinant protein (NP_057455)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377238 HSD17B7 Rabbit polyclonal Antibody
100 ul
$410.00
LY413989 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 7 (HSD17B7) (as WB positive control) 100 ug
$436.00

Other products for "HSD17B7 or NM_016371"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209534
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC209534 protein sequence
Red=Cloning site Green=Tags(s)

MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV
FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE
TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN
FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN
PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057455
RefSeq Size 1533
RefSeq ORF 1023
Synonyms PRAP; SDR37C1
Locus ID 51478
UniProt ID P56937
Cytogenetics 1q23.3
Summary HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol (Marijanovic et al., 2003 PubMed 12829805).supplied by OMIM, May 2010
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways, Steroid biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSD17B7" proteins (3)
SKU Description Size Price
LC413989 Lyophilized HSD17B7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413989 Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 7 (HSD17B7) (as WB positive control) 100 ug
$436.00
TP309534 Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 7 (HSD17B7), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products