OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AADACL2 (NM_207365) Human Mass Spec Standard

Be the first to review this product
SKU
PH309371
AADACL2 MS Standard C13 and N15-labeled recombinant protein (NP_997248)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321954 Anti-AADACL2 Rabbit Polyclonal Antibody
100 ul
$305.00
LY403986 Transient overexpression lysate of arylacetamide deacetylase-like 2 (AADACL2) (as WB positive control) 100 ug
$436.00

Other products for "AADACL2 or NM_207365"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209371
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC209371 protein sequence
Red=Cloning site Green=Tags(s)

MPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDYTQPLSDEYITVTDTTFVDIPVR
LYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLA
AVKFFLLEKILTKYGVDPTRICISGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGLQITDSYLPSH
RENEHGIVLTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEPIL
GGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQVVHEHIEDGIHG
ALSFMTSPFYLRLGLRIRDMYVSWLDKNL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997248
RefSeq Size 1513
RefSeq ORF 1137
Locus ID 344752
UniProt ID Q6P093
Cytogenetics 3q25.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AADACL2" proteins (3)
SKU Description Size Price
LC403986 Lyophilized AADACL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403986 Transient overexpression lysate of arylacetamide deacetylase-like 2 (AADACL2) (as WB positive control) 100 ug
$436.00
TP309371 Recombinant protein of human arylacetamide deacetylase-like 2 (AADACL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products