OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCGB2A1 (NM_002407) Human Mass Spec Standard

Be the first to review this product
SKU
PH309362
SCGB2A1 MS Standard C13 and N15-labeled recombinant protein (NP_002398)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314191 Rabbit polyclonal Mammaglobin B antibody
100 ul
$380.00
LY400860 Transient overexpression lysate of secretoglobin, family 2A, member 1 (SCGB2A1) (as WB positive control) 100 ug
$436.00

Other products for "SCGB2A1 or NM_002407"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209362
Predicted MW 10.9 kDa
Protein Sequence
Protein Sequence
>RC209362 protein sequence
Red=Cloning site Green=Tags(s)

MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQS
HRTLKNFGLMMHTVYDSIWCNMKSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002398
RefSeq Size 521
RefSeq ORF 285
Synonyms LPHC; LPNC; MGB2; UGB3
Locus ID 4246
UniProt ID O75556
Cytogenetics 11q12.3
Summary May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCGB2A1" proteins (3)
SKU Description Size Price
LC400860 Lyophilized SCGB2A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400860 Transient overexpression lysate of secretoglobin, family 2A, member 1 (SCGB2A1) (as WB positive control) 100 ug
$436.00
TP309362 Recombinant protein of human secretoglobin, family 2A, member 1 (SCGB2A1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products