OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cystatin SA (CST2) (NM_001322) Human Mass Spec Standard

Be the first to review this product
SKU
PH309350
CST2 MS Standard C13 and N15-labeled recombinant protein (NP_001313)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504259 CST2 (Cystatin SA) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6) 100 ul
$447.00
LY420010 Transient overexpression lysate of cystatin SA (CST2) (as WB positive control) 100 ug
$436.00

Other products for "Cystatin SA or NM_001322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209350
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC209350 protein sequence
Red=Cloning site Green=Tags(s)

MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV
LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE
A

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001313
RefSeq Size 694
RefSeq ORF 423
Locus ID 1470
UniProt ID P09228
Cytogenetics 20p11.21
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cystatin SA" proteins (4)
SKU Description Size Price
LC420010 Lyophilized CST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420010 Transient overexpression lysate of cystatin SA (CST2) (as WB positive control) 100 ug
$436.00
TP309350 Recombinant protein of human cystatin SA (CST2), 20 µg 20 ug
$867.00
TP720294 Recombinant protein of human cystatin SA (CST2) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products