OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TUBA3D (NM_080386) Human Mass Spec Standard

Be the first to review this product
SKU
PH309276
TUBA3D MS Standard C13 and N15-labeled recombinant protein (NP_525125)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403306 Transient overexpression lysate of tubulin, alpha 3d (TUBA3D) (as WB positive control) 100 ug
$436.00

Other products for "TUBA3D or NM_080386"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209276
Predicted MW 50 kDa
Protein Sequence
Protein Sequence
>RC209276 protein sequence
Red=Cloning site Green=Tags(s)

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL
EPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS
FGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK
AYHEQLSVAEITNACFEPANQMVKYDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_525125
RefSeq Size 1646
RefSeq ORF 1350
Synonyms H2-ALPHA; KTCN9; TUBA2
Locus ID 113457
UniProt ID P0DPH7
Cytogenetics 2q21.1
Summary This gene encodes a member of the alpha tubulin family. Tubulin is a major component of microtubules, which are composed of alpha- and beta-tubulin heterodimers and microtubule-associated proteins in the cytoskeleton. Microtubules maintain cellular structure, function in intracellular transport, and play a role in spindle formation during mitosis. provided by RefSeq, Oct 2011
Protein Families Druggable Genome
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TUBA3D" proteins (3)
SKU Description Size Price
LC403306 Lyophilized TUBA3D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403306 Transient overexpression lysate of tubulin, alpha 3d (TUBA3D) (as WB positive control) 100 ug
$436.00
TP309276 Recombinant protein of human tubulin, alpha 3d (TUBA3D), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products