OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNAQ (NM_002072) Human Mass Spec Standard

Be the first to review this product
SKU
PH309199
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311219 Goat Anti-GNAQ / ALPHA-q (aa162-175) Antibody
100 ug
$565.00
LY400763 Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) (as WB positive control) 100 ug
$436.00

Other products for "GNAQ or NM_002072"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209199
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC209199 protein sequence
Red=Cloning site Green=Tags(s)

MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE
DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG
IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE
EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
LNLKEYNLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002063
RefSeq Size 6343
RefSeq ORF 1077
Synonyms CMC1; G-ALPHA-q; GAQ; SWS
Locus ID 2776
UniProt ID P50148
Cytogenetics 9q21.2
Summary This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.provided by RefSeq, Nov 2010
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Calcium signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Long-term depression, Long-term potentiation, Melanogenesis, Vascular smooth muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNAQ" proteins (3)
SKU Description Size Price
LC400763 Lyophilized GNAQ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400763 Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) (as WB positive control) 100 ug
$436.00
TP309199 Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products