OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Estrogen Related Receptor alpha (ESRRA) (NM_004451) Human Mass Spec Standard

Be the first to review this product
SKU
PH309028
ESRRA MS Standard C13 and N15-labeled recombinant protein (NP_004442)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808637 ESRRA mouse monoclonal antibody, clone OTI2C12 (formerly 2C12) 100 ul
$447.00
LY417978 Transient overexpression lysate of estrogen-related receptor alpha (ESRRA) (as WB positive control) 100 ug
$436.00

Other products for "Estrogen Related Receptor alpha or NM_004451"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209028
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC209028 representing NM_004451
Red=Cloning site Green=Tags(s)

MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLV
LSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCL
RVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLY
AMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPL
QDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ
LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004442
RefSeq Size 2284
RefSeq ORF 1269
Synonyms ERR1; ERRa; ERRalpha; ESRL1; NR3B1
Locus ID 2101
UniProt ID P11474
Cytogenetics 11q13.1
Summary The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1. provided by RefSeq, Jun 2019
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Estrogen Related Receptor alpha" proteins (3)
SKU Description Size Price
LC417978 Lyophilized ESRRA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417978 Transient overexpression lysate of estrogen-related receptor alpha (ESRRA) (as WB positive control) 100 ug
$436.00
TP309028 Purified recombinant protein of Homo sapiens estrogen-related receptor alpha (ESRRA), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products