OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Josephin 2 (JOSD2) (NM_138334) Human Mass Spec Standard

Be the first to review this product
SKU
PH309025
JOSD2 MS Standard C13 and N15-labeled recombinant protein (NP_612207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340284 Rabbit Polyclonal Anti-JOSD2 Antibody
100 ul
$585.00
LY408621 Transient overexpression lysate of Josephin domain containing 2 (JOSD2) (as WB positive control) 100 ug
$436.00

Other products for "Josephin 2 or NM_138334"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209025
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC209025 protein sequence
Red=Cloning site Green=Tags(s)

MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV
NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD
SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612207
RefSeq Size 863
RefSeq ORF 564
Synonyms SBBI54
Locus ID 126119
UniProt ID Q8TAC2
Cytogenetics 19q13.33
Summary This gene encodes a protein containing a Josephin domain. Josephin domain-containing proteins are deubiquitinating enzymes which catalyze the hydrolysis of the bond between the C-terminal glycine of the ubiquitin peptide and protein substrates. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jul 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Josephin 2" proteins (3)
SKU Description Size Price
LC408621 Lyophilized JOSD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408621 Transient overexpression lysate of Josephin domain containing 2 (JOSD2) (as WB positive control) 100 ug
$436.00
TP309025 Recombinant protein of human Josephin domain containing 2 (JOSD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products