OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUS1L (NM_022156) Human Mass Spec Standard

Be the first to review this product
SKU
PH309015
DUS1L MS Standard C13 and N15-labeled recombinant protein (NP_071439)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344690 Rabbit Polyclonal Anti-DUS1L Antibody - middle region
100 ul
$585.00
LY411733 Transient overexpression lysate of dihydrouridine synthase 1-like (S. cerevisiae) (DUS1L) (as WB positive control) 100 ug
$436.00

Other products for "DUS1L or NM_022156"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209015
Predicted MW 53.2 kDa
Protein Sequence
Protein Sequence
>RC209015 protein sequence
Red=Cloning site Green=Tags(s)

MPKLQGFEFWSRTLRGARHVVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANYRKENLYCEVC
PEDRPLIVQFCANDPEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGHYGAFLQDEWDLLQRMILLAHEKL
SVPVTCKIRVFPEIDKTVRYAQMLEKAGCQLLTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGN
IQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREHPCPLSYVRAHLFKLWHH
TLQVHQELREELAKVKTLEGIAAVSQELKLRCQEEISRQEGAKPTGDLPFHWICQPYIRPGPREGSKEKA
GARSKRALEEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVFSLCRGCCKKRAS
KETADCPGHGLLFKTKLEKSLAWKEAQPELQEPQPAAPGTPGGFSEVMGSALA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071439
RefSeq Size 1904
RefSeq ORF 1419
Synonyms DUS1; PP3111
Locus ID 64118
UniProt ID Q6P1R4
Cytogenetics 17q25.3
Summary Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUS1L" proteins (3)
SKU Description Size Price
LC411733 Lyophilized DUS1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411733 Transient overexpression lysate of dihydrouridine synthase 1-like (S. cerevisiae) (DUS1L) (as WB positive control) 100 ug
$436.00
TP309015 Recombinant protein of human dihydrouridine synthase 1-like (S. cerevisiae) (DUS1L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products