OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Diazepam Binding Inhibitor (DBI) (NM_020548) Human Mass Spec Standard

Be the first to review this product
SKU
PH308982
DBI MS Standard C13 and N15-labeled recombinant protein (NP_065438)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813070 DBI mouse monoclonal antibody,clone OTI6E12 100 ul
$447.00
LY412418 Transient overexpression lysate of diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Diazepam Binding Inhibitor or NM_020548"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208982
Predicted MW 11.8 kDa
Protein Sequence
Protein Sequence
>RC208982 protein sequence
Red=Cloning site Green=Tags(s)

MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK
AKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065438
RefSeq Size 745
RefSeq ORF 312
Synonyms ACBD1; ACBP; CCK-RP; EP
Locus ID 1622
UniProt ID P07108
Cytogenetics 2q14.2
Summary This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways PPAR signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Diazepam Binding Inhibitor" proteins (3)
SKU Description Size Price
LC412418 Lyophilized DBI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412418 Transient overexpression lysate of diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308982 Recombinant protein of human diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products