OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PXDC1 (NM_183373) Human Mass Spec Standard

Be the first to review this product
SKU
PH308954
C6orf145 MS Standard C13 and N15-labeled recombinant protein (NP_899229)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405253 Transient overexpression lysate of chromosome 6 open reading frame 145 (C6orf145) (as WB positive control) 100 ug
$436.00

Other products for "PXDC1 or NM_183373"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208954
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC208954 protein sequence
Red=Cloning site Green=Tags(s)

MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDA
FPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDN
VHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNGRDQHLGVDPTEHLFENGSEFPSELEDGDDP
AAYVTNLSYYHLVPFETDIWD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899229
RefSeq Size 2211
RefSeq ORF 693
Synonyms C6orf145
Locus ID 221749
UniProt ID Q5TGL8
Cytogenetics 6p25.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PXDC1" proteins (3)
SKU Description Size Price
LC405253 Lyophilized PXDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405253 Transient overexpression lysate of chromosome 6 open reading frame 145 (C6orf145) (as WB positive control) 100 ug
$436.00
TP308954 Recombinant protein of human chromosome 6 open reading frame 145 (C6orf145), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products