OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTPN5 (NM_006906) Human Mass Spec Standard

Be the first to review this product
SKU
PH308953
PTPN5 MS Standard C13 and N15-labeled recombinant protein (NP_008837)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349114 Rabbit Polyclonal Anti-PTPN5 Antibody
100 ug
$640.00
LY416327 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PTPN5 or NM_006906"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208953
Predicted MW 63.5 kDa
Protein Sequence
Protein Sequence
>RC208953 protein sequence
Red=Cloning site Green=Tags(s)

MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQ
KPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGT
WGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDP
VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLS
ASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL
SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD
GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCA
PIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS
HQSPE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008837
RefSeq Size 3201
RefSeq ORF 1695
Synonyms PTPSTEP; STEP; STEP61
Locus ID 84867
UniProt ID P54829
Cytogenetics 11p15.1
Summary May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Phosphatase, Transmembrane
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTPN5" proteins (11)
SKU Description Size Price
PH317371 PTPN5 MS Standard C13 and N15-labeled recombinant protein (NP_116170) 10 ug
$3,360.00
LC403199 Lyophilized PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416327 Lyophilized PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421867 Lyophilized PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429321 Lyophilized PTPN5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403199 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416327 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421867 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY429321 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308953 Recombinant protein of human protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 1, 20 µg 20 ug
$737.00
TP317371 Recombinant protein of human protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (PTPN5), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products