OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRAP (NM_006613) Human Mass Spec Standard

Be the first to review this product
SKU
PH308908
GRAP MS Standard C13 and N15-labeled recombinant protein (NP_006604)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369597 GRAP rabbit polyclonal antibody
100 ul
$310.00
LY416529 Transient overexpression lysate of GRB2-related adaptor protein (GRAP) (as WB positive control) 100 ug
$436.00

Other products for "GRAP or NM_006613"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208908
Predicted MW 25.3 kDa
Protein Sequence
Protein Sequence
>RC208908 protein sequence
Red=Cloning site Green=Tags(s)

MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQLA
EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTI
AKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRS
YVQPVHL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006604
RefSeq Size 2089
RefSeq ORF 651
Synonyms DFNB114
Locus ID 10750
UniProt ID Q13588
Cytogenetics 17p11.2
Summary This gene encodes a member of the GRB2/Sem5/Drk family and functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain. In general, it couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. provided by RefSeq, Jul 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRAP" proteins (3)
SKU Description Size Price
LC416529 Lyophilized GRAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416529 Transient overexpression lysate of GRB2-related adaptor protein (GRAP) (as WB positive control) 100 ug
$436.00
TP308908 Recombinant protein of human GRB2-related adaptor protein (GRAP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products