OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TXN (NM_003329) Human Mass Spec Standard

Be the first to review this product
SKU
PH308876
TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418748 Transient overexpression lysate of thioredoxin (TXN) (as WB positive control) 100 ug
$436.00

Other products for "TXN or NM_003329"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208876
Predicted MW 11.7 kDa
Protein Sequence
Protein Sequence
>RC208876 protein sequence
Red=Cloning site Green=Tags(s)

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE
VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003320
RefSeq Size 886
RefSeq ORF 315
Synonyms TRDX; TRX; TRX1; Trx80
Locus ID 7295
UniProt ID P10599
Cytogenetics 9q31.3
Summary The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TXN" proteins (4)
SKU Description Size Price
LC418748 Lyophilized TXN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418748 Transient overexpression lysate of thioredoxin (TXN) (as WB positive control) 100 ug
$436.00
TP308876 Recombinant protein of human thioredoxin (TXN), 20 µg 20 ug
$867.00
TP720851 Purified recombinant protein of Human thioredoxin (TXN) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products