OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CMC1 (NM_182523) Human Mass Spec Standard

Be the first to review this product
SKU
PH308801
CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366594 CMC1 rabbit polyclonal antibody
100 ul
$310.00
LY405501 Transient overexpression lysate of COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "CMC1 or NM_182523"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208801
Predicted MW 12.5 kDa
Protein Sequence
Protein Sequence
>RC208801 protein sequence
Red=Cloning site Green=Tags(s)

MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND
PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872329
RefSeq Size 640
RefSeq ORF 318
Synonyms C3orf68
Locus ID 152100
UniProt ID Q7Z7K0
Cytogenetics 3p24.1
Summary Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CMC1" proteins (3)
SKU Description Size Price
LC405501 Lyophilized CMC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405501 Transient overexpression lysate of COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP308801 Recombinant protein of human COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products