OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR58 (THOC6) (NM_024339) Human Mass Spec Standard

Be the first to review this product
SKU
PH308694
THOC6 MS Standard C13 and N15-labeled recombinant protein (NP_077315)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367370 THOC6 rabbit polyclonal antibody
100 ul
$310.00
LY411297 Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "WDR58 or NM_024339"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208694
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC208694 protein sequence
Red=Cloning site Green=Tags(s)

MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVV
TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS
LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYK
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCV
NQWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077315
RefSeq Size 1444
RefSeq ORF 1023
Synonyms fSAP35; WDR58
Locus ID 79228
UniProt ID Q86W42
Cytogenetics 16p13.3
Summary This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome. provided by RefSeq, Dec 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WDR58" proteins (5)
SKU Description Size Price
LC411297 Lyophilized THOC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428050 Lyophilized THOC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411297 Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428050 Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP308694 Recombinant protein of human THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products