OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APCDD1 (NM_153000) Human Mass Spec Standard

Be the first to review this product
SKU
PH308639
APCDD1 MS Standard C13 and N15-labeled recombinant protein (NP_694545)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367480 APCDD1 rabbit polyclonal antibody
100 ul
$310.00
LY403498 Transient overexpression lysate of adenomatosis polyposis coli down-regulated 1 (APCDD1) (as WB positive control) 100 ug
$436.00

Other products for "APCDD1 or NM_153000"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208639
Predicted MW 58.8 kDa
Protein Sequence
Protein Sequence
>RC208639 protein sequence
Red=Cloning site Green=Tags(s)

MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMP
PTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGG
TEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQ
LIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPI
LPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRG
VLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHT
EYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPG
RHTWSLLLAALACLVPLLHWNIRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694545
RefSeq Size 2579
RefSeq ORF 1542
Synonyms B7323; DRAPC1; FP7019; HHS; HTS; HYPT1
Locus ID 147495
UniProt ID Q8J025
Cytogenetics 18p11.22
Summary This locus encodes an inhibitor of the Wnt signaling pathway. Mutations at this locus have been associated with hereditary hypotrichosis simplex. Increased expression of this gene may also be associated with colorectal carcinogenesis.provided by RefSeq, Sep 2010
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APCDD1" proteins (3)
SKU Description Size Price
LC403498 Lyophilized APCDD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403498 Transient overexpression lysate of adenomatosis polyposis coli down-regulated 1 (APCDD1) (as WB positive control) 100 ug
$436.00
TP308639 Recombinant protein of human adenomatosis polyposis coli down-regulated 1 (APCDD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products