OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MDP1 (NM_138476) Human Mass Spec Standard

Be the first to review this product
SKU
PH308609
MDP1 MS Standard C13 and N15-labeled recombinant protein (NP_612485)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340302 Rabbit Polyclonal Anti-MDP-1 Antibody
100 ul
$585.00
LY403357 Transient overexpression lysate of magnesium-dependent phosphatase 1 (MDP1) (as WB positive control) 100 ug
$436.00

Other products for "MDP1 or NM_138476"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208609
Predicted MW 20.1 kDa
Protein Sequence
Protein Sequence
>RC208609 protein sequence
Red=Cloning site Green=Tags(s)

MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASR
TSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIH
IQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612485
RefSeq Size 760
RefSeq ORF 528
Synonyms FN6PASE; MDP-1
Locus ID 145553
UniProt ID Q86V88
Cytogenetics 14q12
Summary Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MDP1" proteins (3)
SKU Description Size Price
LC403357 Lyophilized MDP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403357 Transient overexpression lysate of magnesium-dependent phosphatase 1 (MDP1) (as WB positive control) 100 ug
$436.00
TP308609 Recombinant protein of human magnesium-dependent phosphatase 1 (MDP-1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products