OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPA4 (NM_016352) Human Mass Spec Standard

Be the first to review this product
SKU
PH308575
CPA4 MS Standard C13 and N15-labeled recombinant protein (NP_057436)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360674 CPA4 Antibody - middle region
100 ul
$585.00
LY402543 Transient overexpression lysate of carboxypeptidase A4 (CPA4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CPA4 or NM_016352"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208575
Predicted MW 47.4 kDa
Protein Sequence
Protein Sequence
>RC208575 protein sequence
Red=Cloning site Green=Tags(s)

MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPS
VSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADF
PDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITS
ILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP
HANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEY
QVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Y

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057436
RefSeq Size 2817
RefSeq ORF 1263
Synonyms CPA3
Locus ID 51200
UniProt ID Q9UI42
Cytogenetics 7q32.2
Summary This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPA4" proteins (5)
SKU Description Size Price
LC402543 Lyophilized CPA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431341 Lyophilized CPA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402543 Transient overexpression lysate of carboxypeptidase A4 (CPA4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431341 Transient overexpression lysate of carboxypeptidase A4 (CPA4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP308575 Recombinant protein of human carboxypeptidase A4 (CPA4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products