OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAM83A (NM_032899) Human Mass Spec Standard

Be the first to review this product
SKU
PH308565
FAM83A MS Standard C13 and N15-labeled recombinant protein (NP_116288)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335330 Rabbit Polyclonal Anti-FAM83A Antibody
100 ul
$585.00
LY409861 Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FAM83A or NM_032899"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208565
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC208565 protein sequence
Red=Cloning site Green=Tags(s)

MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQY
IQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHSWASAEKPYLKEKSSATVYFQ
TVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQI
SDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVE
LFDEEFRHLYASSKPVMGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVS
ASSGPCSPAAPHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL
TPTWRPFLQASPHF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116288
RefSeq Size 4596
RefSeq ORF 1302
Synonyms BJ-TSA-9
Locus ID 84985
UniProt ID Q86UY5
Cytogenetics 8q24.13
Summary Probable proto-oncogene that functions in the epidermal growth factor receptor/EGFR signaling pathway. Activates both RAS/MAPK and PI3K/AKT/TOR signaling cascades downstream of EGFR. Required for the RAS/MAPK signaling cascade activation upon EGFR stimulation, it also activates both signaling cascades independently of EGFR activation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAM83A" proteins (5)
SKU Description Size Price
LC404130 Lyophilized FAM83A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409861 Lyophilized FAM83A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404130 Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409861 Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308565 Recombinant protein of human family with sequence similarity 83, member A (FAM83A), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products