OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FBXO3 (NM_012175) Human Mass Spec Standard

Be the first to review this product
SKU
PH308494
FBXO3 MS Standard C13 and N15-labeled recombinant protein (NP_036307)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329823 Rabbit Polyclonal Anti-FBXO3 Antibody
100 ul
$585.00
LY409557 Transient overexpression lysate of F-box protein 3 (FBXO3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FBXO3 or NM_012175"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208494
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC208494 protein sequence
Red=Cloning site Green=Tags(s)

MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQ
KNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPD
DYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAV
EAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVAT
TGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG
EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036307
RefSeq Size 2408
RefSeq ORF 1413
Synonyms FBA; FBX3
Locus ID 26273
UniProt ID Q9UK99
Cytogenetics 11p13
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FBXO3" proteins (5)
SKU Description Size Price
LC409557 Lyophilized FBXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415952 Lyophilized FBXO3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409557 Transient overexpression lysate of F-box protein 3 (FBXO3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415952 Transient overexpression lysate of F-box protein 3 (FBXO3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308494 Recombinant protein of human F-box protein 3 (FBXO3), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products