DHFRL1 (DHFR2) (NM_176815) Human Mass Spec Standard

CAT#: PH308452

DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785)

Product Images

Coomassie blue staining of purified DHFR2 protein (Cat# TP308452). The protein was produced from HEK293T cells transfected with DHFR2 cDNA clone (Cat# RC208452) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208452
• Predicted MW: 21.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208452 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD
  RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM
  QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_789785
• RefSeq Size: 3934
• RefSeq ORF: 561
• Synonyms: DHFRL1; DHFRP4
• Locus ID: 200895
• UniProt ID: Q86XF0
• Cytogenetics: 3q11.2
• Summary: Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome