OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHFRL1 (DHFR2) (NM_176815) Human Mass Spec Standard

Be the first to review this product
SKU
PH308452
DHFRL1 MS Standard C13 and N15-labeled recombinant protein (NP_789785)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503259 DHFRL1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2) 100 ul
$447.00
LY406051 Transient overexpression lysate of dihydrofolate reductase-like 1 (DHFRL1) (as WB positive control) 100 ug
$436.00

Other products for "DHFRL1 or NM_176815"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208452
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC208452 protein sequence
Red=Cloning site Green=Tags(s)

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD
RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM
QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789785
RefSeq Size 3934
RefSeq ORF 561
Synonyms DHFRL1; DHFRP4
Locus ID 200895
UniProt ID Q86XF0
Cytogenetics 3q11.2
Summary Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHFRL1" proteins (3)
SKU Description Size Price
LC406051 Lyophilized DHFRL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406051 Transient overexpression lysate of dihydrofolate reductase-like 1 (DHFRL1) (as WB positive control) 100 ug
$436.00
TP308452 Recombinant protein of human dihydrofolate reductase-like 1 (DHFRL1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products