OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APOBEC2 (NM_006789) Human Mass Spec Standard

Be the first to review this product
SKU
PH308399
APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345985 Rabbit Polyclonal Anti-APOBEC2 Antibody
100 ul
$525.00
LY416413 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) (as WB positive control) 100 ug
$436.00

Other products for "APOBEC2 or NM_006789"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208399
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC208399 representing NM_006789
Red=Cloning site Green=Tags(s)

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL
CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS
KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE
NFLYYEEKLADILK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006780
RefSeq Size 1195
RefSeq ORF 672
Synonyms ARCD1; ARP1
Locus ID 10930
UniProt ID Q9Y235
Cytogenetics 6p21.1
Summary Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APOBEC2" proteins (3)
SKU Description Size Price
LC416413 Lyophilized APOBEC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416413 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) (as WB positive control) 100 ug
$436.00
TP308399 Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products