OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OAF (NM_178507) Human Mass Spec Standard

Be the first to review this product
SKU
PH308300
OAF MS Standard C13 and N15-labeled recombinant protein (NP_848602)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343333 Rabbit Polyclonal Anti-OAF Antibody
100 ul
$585.00
LY405896 Transient overexpression lysate of OAF homolog (Drosophila) (OAF) (as WB positive control) 100 ug
$436.00

Other products for "OAF or NM_178507"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208300
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC208300 protein sequence
Red=Cloning site Green=Tags(s)

MRLPGVPLARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVS
FTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHL
HMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLEQGVDSSVFEALPKASEQAELPRCRQVGDH
GKPCVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCLWDEDPYPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848602
RefSeq Size 1957
RefSeq ORF 819
Synonyms NS5ATP13TP2
Locus ID 220323
UniProt ID Q86UD1
Cytogenetics 11q23.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OAF" proteins (3)
SKU Description Size Price
LC405896 Lyophilized OAF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405896 Transient overexpression lysate of OAF homolog (Drosophila) (OAF) (as WB positive control) 100 ug
$436.00
TP308300 Recombinant protein of human OAF homolog (Drosophila) (OAF), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products