OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM17 (NM_198276) Human Mass Spec Standard

Be the first to review this product
SKU
PH308232
TMEM17 MS Standard C13 and N15-labeled recombinant protein (NP_938017)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405002 Transient overexpression lysate of transmembrane protein 17 (TMEM17) (as WB positive control) 100 ug
$436.00

Other products for "TMEM17 or NM_198276"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208232
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC208232 protein sequence
Red=Cloning site Green=Tags(s)

MELPDPVRQRLGNFSRAVFSDSNRTSPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYS
ILPDYYKFIVITVIILITLIEAIRLYLGYVGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLE
KAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_938017
RefSeq Size 1925
RefSeq ORF 594
Locus ID 200728
UniProt ID Q86X19
Cytogenetics 2p15
Summary Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM17" proteins (3)
SKU Description Size Price
LC405002 Lyophilized TMEM17 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405002 Transient overexpression lysate of transmembrane protein 17 (TMEM17) (as WB positive control) 100 ug
$436.00
TP308232 Recombinant protein of human transmembrane protein 17 (TMEM17), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products