OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPINDOC (NM_138471) Human Mass Spec Standard

Be the first to review this product
SKU
PH308181
C11orf84 MS Standard C13 and N15-labeled recombinant protein (NP_612480)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357056 SPINDOC Antibody - N-terminal region
100 ul
$585.00
LY408595 Transient overexpression lysate of chromosome 11 open reading frame 84 (C11orf84) (as WB positive control) 100 ug
$436.00

Other products for "SPINDOC or NM_138471"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208181
Predicted MW 41 kDa
Protein Sequence
Protein Sequence
>RC208181 protein sequence
Red=Cloning site Green=Tags(s)

MALKAEGAALDCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQ
VSWEQEFLVGSSPGGSGRALCMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSNILEAWSEGVALLQ
DVRAEQPSPPNSDSGQDAHPDPDANPDAARMPAEIVVLLDSEDNPSLPKRSRPRGLRPLELPAVPATEPG
NKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFS
HTQLRGPDSKDSPKDREVAEGGLPRAESPSPAPPPGLRGTLDLQVIRVRMEEPPAVSLLQDWSRHPQGTK
RVGAGDTSDWPTVLSESSTTVAGKPEKGNGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612480
RefSeq Size 2004
RefSeq ORF 1143
Synonyms C11orf84; SPIN-DOC
Locus ID 144097
UniProt ID Q9BUA3
Cytogenetics 11q13.1
Summary Negatively regulates the transcriptional activator activity of SPIN1 via inhibition of its histone methyl-binding ability. Represses the expression of a number of SPIN1-regulated genes and the SPIN1-mediated activation of the Wnt signaling pathway. Can also inhibit the histone methyl-binding abilities of SPIN2A, SPIN2B, SPIN3 and SPIN4 (PubMed:29061846).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPINDOC" proteins (3)
SKU Description Size Price
LC408595 Lyophilized C11orf84 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408595 Transient overexpression lysate of chromosome 11 open reading frame 84 (C11orf84) (as WB positive control) 100 ug
$436.00
TP308181 Recombinant protein of human chromosome 11 open reading frame 84 (C11orf84), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products