OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GIMAP1 (NM_130759) Human Mass Spec Standard

Be the first to review this product
SKU
PH308167
GIMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_570115)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342102 Rabbit Polyclonal Anti-GIMAP1 Antibody
100 ul
$585.00
LY408926 Transient overexpression lysate of GTPase, IMAP family member 1 (GIMAP1) (as WB positive control) 100 ug
$436.00

Other products for "GIMAP1 or NM_130759"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208167
Predicted MW 34.4 kDa
Protein Sequence
Protein Sequence
>RC208167 protein sequence
Red=Cloning site Green=Tags(s)

MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGATSVTRACTTGS
RRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQLGRFTAQDQQAVRQVRDMFG
EDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEG
LVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL
LLGGALLFWVLLHRRWSEAVAEVGPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570115
RefSeq Size 4430
RefSeq ORF 918
Synonyms HIMAP1; IAN2; IMAP1; IMAP38
Locus ID 170575
UniProt ID Q8WWP7
Cytogenetics 7q36.1
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene is thought to be involved in the differentiation of T helper (Th) cells of the Th1 lineage, and the related mouse gene has been shown to be critical for the development of mature B and T lymphocytes. Read-through transcription exists between this gene and the downstream GIMAP5 (GTPase, IMAP family member 5) gene. provided by RefSeq, Dec 2010
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GIMAP1" proteins (3)
SKU Description Size Price
LC408926 Lyophilized GIMAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408926 Transient overexpression lysate of GTPase, IMAP family member 1 (GIMAP1) (as WB positive control) 100 ug
$436.00
TP308167 Recombinant protein of human GTPase, IMAP family member 1 (GIMAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products