OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RP2 (NM_006915) Human Mass Spec Standard

Be the first to review this product
SKU
PH308124
RP2 MS Standard C13 and N15-labeled recombinant protein (NP_008846)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345130 Rabbit Polyclonal Anti-RP2 Antibody - middle region
100 ul
$585.00
LY416325 Transient overexpression lysate of retinitis pigmentosa 2 (X-linked recessive) (RP2) (as WB positive control) 100 ug
$436.00

Other products for "RP2 or NM_006915"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208124
Predicted MW 39.6 kDa
Protein Sequence
Protein Sequence
>RC208124 protein sequence
Red=Cloning site Green=Tags(s)

MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENC
NIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESS
SNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAV
RVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRV
FREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008846
RefSeq Size 3831
RefSeq ORF 1050
Synonyms DELXp11.3; NM23-H10; NME10; TBCCD2; XRP2
Locus ID 6102
UniProt ID O75695
Cytogenetics Xp11.3
Summary The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RP2" proteins (3)
SKU Description Size Price
LC416325 Lyophilized RP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416325 Transient overexpression lysate of retinitis pigmentosa 2 (X-linked recessive) (RP2) (as WB positive control) 100 ug
$436.00
TP308124 Recombinant protein of human retinitis pigmentosa 2 (X-linked recessive) (RP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products