OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASL12 (NM_016563) Human Mass Spec Standard

Be the first to review this product
SKU
PH308117
RASL12 MS Standard C13 and N15-labeled recombinant protein (NP_057647)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345009 Rabbit Polyclonal Anti-RASL12 Antibody - N-terminal region
100 ul
$585.00
LY413889 Transient overexpression lysate of RAS-like, family 12 (RASL12) (as WB positive control) 100 ug
$436.00

Other products for "RASL12 or NM_016563"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208117
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC208117 protein sequence
Red=Cloning site Green=Tags(s)

MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHL
RVMDTADLDTPRNCERYLNWAHAFLVVYSVDSRQSFDSSSSYLELLALHAKETQRSIPALLLGNKLDMAQ
YRQVTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAVREARRELEKSPLTRPLFISEERALPHQAPL
TARHGLASCTFNTLSTINLKEMPTVAQAKLVTVKSSRAQSKRKAPTLTLLKGFKIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057647
RefSeq Size 2603
RefSeq ORF 798
Synonyms RIS
Locus ID 51285
UniProt ID Q9NYN1
Cytogenetics 15q22.31
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RASL12" proteins (3)
SKU Description Size Price
LC413889 Lyophilized RASL12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413889 Transient overexpression lysate of RAS-like, family 12 (RASL12) (as WB positive control) 100 ug
$436.00
TP308117 Recombinant protein of human RAS-like, family 12 (RASL12), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products