OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLAP2 (SLA2) (NM_032214) Human Mass Spec Standard

Be the first to review this product
SKU
PH308103
SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505126 SLA2 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7) 100 ul
$447.00
LY410277 Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SLAP2 or NM_032214"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208103
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC208103 protein sequence
Red=Cloning site Green=Tags(s)

MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT
VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA
SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV
QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115590
RefSeq Size 2569
RefSeq ORF 783
Synonyms C20orf156; MARS; SLAP-2; SLAP2
Locus ID 84174
UniProt ID Q9H6Q3
Cytogenetics 20q11.23
Summary This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. Two transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLAP2" proteins (5)
SKU Description Size Price
LC406314 Lyophilized SLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410277 Lyophilized SLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406314 Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410277 Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308103 Recombinant protein of human Src-like-adaptor 2 (SLA2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products