OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VPS4B (NM_004869) Human Mass Spec Standard

Be the first to review this product
SKU
PH308019
VPS4B MS Standard C13 and N15-labeled recombinant protein (NP_004860)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351918 Rabbit Polyclonal Anti-VPS4B Antibody
100 ul
$205.00
LY401522 Transient overexpression lysate of vacuolar protein sorting 4 homolog B (S. cerevisiae) (VPS4B) (as WB positive control) 100 ug
$436.00

Other products for "VPS4B or NM_004869"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208019
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC208019 protein sequence
Red=Cloning site Green=Tags(s)

MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAE
KLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQLQGAIVIERPNVKWSDVAGLE
GAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLG
ESEKLVKNLFQLARENKPSIIFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNI
PWVLDSAIRRRFEKRIYIPLPEPHARAAMFKLHLGTTQNSLTEADFRELGRKTDGYSGADISIIVRDALM
QPVRKVQSATHFKKVRGPSRADPNHLVDDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSN
TKPTVNEHDLLKLKKFTEDFGQEG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004860
RefSeq Size 3396
RefSeq ORF 1332
Synonyms MIG1; SKD1; SKD1B; VPS4-2
Locus ID 9525
UniProt ID O75351
Cytogenetics 18q21.33
Summary The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. Mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be a yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 18; the gene for the other resides on chromosome 16. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VPS4B" proteins (3)
SKU Description Size Price
LC401522 Lyophilized VPS4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401522 Transient overexpression lysate of vacuolar protein sorting 4 homolog B (S. cerevisiae) (VPS4B) (as WB positive control) 100 ug
$436.00
TP308019 Recombinant protein of human vacuolar protein sorting 4 homolog B (S. cerevisiae) (VPS4B), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products