OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRATD2 (NM_174911) Human Mass Spec Standard

Be the first to review this product
SKU
PH307996
FAM84B MS Standard C13 and N15-labeled recombinant protein (NP_777571)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501916 FAM84B mouse monoclonal antibody, clone OTI4A4 (formerly 4A4) 100 ul
$447.00
LY406394 Transient overexpression lysate of family with sequence similarity 84, member B (FAM84B) (as WB positive control) 100 ug
$436.00

Other products for "LRATD2 or NM_174911"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207996
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC207996 protein sequence
Red=Cloning site Green=Tags(s)

MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQ
PQPYDPRLHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNF
QVVHLHRLEVINSFLTDASQGRRGRVVNDLYRYKPLSSSAVVRNALAHVGAKERELSWRNSESFAAWCRY
GKREFKIGGELRIGKQPYRLQIQLSAQRSHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPEE
GDSNVARTTPPPGRPPAPSSEEEDGEAVAH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777571
RefSeq Size 5503
RefSeq ORF 930
Synonyms BCMP101; FAM84B; NSE2
Locus ID 157638
UniProt ID Q96KN1
Cytogenetics 8q24.21
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRATD2" proteins (3)
SKU Description Size Price
LC406394 Lyophilized FAM84B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406394 Transient overexpression lysate of family with sequence similarity 84, member B (FAM84B) (as WB positive control) 100 ug
$436.00
TP307996 Recombinant protein of human family with sequence similarity 84, member B (FAM84B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products